0) ) "context" : "", { }, { "kudosable" : "true", }); "context" : "", }); "event" : "deleteMessage", "actions" : [ "disableKudosForAnonUser" : "false", { { "context" : "", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "eventActions" : [ "actions" : [ { "context" : "", }, "useTruncatedSubject" : "true", count = 0; "action" : "rerender" "action" : "pulsate" ', 'ajax'); ] }, "event" : "unapproveMessage", { ] }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/63029","ajaxErrorEventName":"LITHIUM:ajaxError","token":"9_7V-EwZVcOvhrUNcFS1BVw4BfEFAMdvbazZnCy9mGc. "actions" : [ "}); { { }, "defaultAriaLabel" : "", "showCountOnly" : "false", { { ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1546831,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "truncateBodyRetainsHtml" : "false", "action" : "rerender" } "action" : "rerender" }, "actions" : [ Bist du sicher, dass du fortfahren möchtest? "actions" : [ LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "message" : "1477776", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "lia-deleted-state", { ] }, { } "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { return; "message" : "1477754", } ] { // just for convenience, you need a login anyways... LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); { "event" : "AcceptSolutionAction", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { "actions" : [ "parameters" : { "event" : "addThreadUserEmailSubscription", "actions" : [ "actions" : [ } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "initiatorDataMatcher" : "data-lia-kudos-id" }, "linkDisabled" : "false" "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1478551,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } { "disableLabelLinks" : "false", "action" : "rerender" "parameters" : { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1478551 .lia-rating-control-passive', '#form_6'); ] "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); // Oops. }, }, "eventActions" : [ "showCountOnly" : "false", "event" : "RevokeSolutionAction", } ] $('div[class*="-menu-btn"]').removeClass('active'); { { ] // Reset the conditions so that someone can do it all again. }, "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "kudoEntity", ] return false; { ] "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234240}); } "action" : "pulsate" "kudosable" : "true", "entity" : "1478644", "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" { "context" : "lia-deleted-state", ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "removeThreadUserEmailSubscription", "context" : "envParam:feedbackData", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); ] }, ] { "; clearWarning(pagerId); > 0) ) "includeRepliesModerationState" : "false", "revokeMode" : "true", { { }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1477797 .lia-rating-control-passive', '#form_4'); { }, "context" : "envParam:feedbackData", // console.log('watching: ' + key); { "actions" : [ "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/63029","ajaxErrorEventName":"LITHIUM:ajaxError","token":"jJjdDkbRxGO2NI9Ae0gDCnPh7Qi0mnrcMJ2T0RWDnjs. }, }, { "actions" : [ ] }, "actions" : [ "context" : "", "action" : "rerender" "disableKudosForAnonUser" : "false", ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, // We made it! { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" } ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { }, "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" "message" : "1477797", ] ] } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, "action" : "rerender" { { { }, "actions" : [ }, "dialogKey" : "dialogKey" { }, "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName,message", "actions" : [ .attr('aria-expanded','true'); "context" : "", { "showCountOnly" : "false", { return; } "event" : "MessagesWidgetEditCommentForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,expandedQuiltName", "activecastFullscreen" : false, "action" : "rerender" } { "linkDisabled" : "false" "action" : "pulsate" "truncateBody" : "true", "initiatorBinding" : true, }, ] "action" : "rerender" } }, "truncateBodyRetainsHtml" : "false", } "event" : "MessagesWidgetAnswerForm", "event" : "approveMessage", { // --> return false; }, }, ] { { ] } "disallowZeroCount" : "false", "context" : "envParam:entity", }, "actions" : [ "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" LITHIUM.Dialog.options['-191854142'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Dazu kann man neben einem Handy-Neustart … }); "; Offres fixes; Cartes prépayées; Offres fixes; Ora CLASSIK. "event" : "MessagesWidgetEditCommentForm", $('#node-menu li.active').children('ul').show(); ] } "actions" : [ "actions" : [ "actions" : [ }, { "includeRepliesModerationState" : "false", "useCountToKudo" : "false", LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); }, "entity" : "1478560", { Bist du sicher, dass du fortfahren möchtest? { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); "selector" : "#messageview_7", "event" : "MessagesWidgetEditCommentForm", "actions" : [ "action" : "rerender" // Oops, not the right sequence, lets restart from the top. } } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ "kudosLinksDisabled" : "false", } { count = 0; "event" : "AcceptSolutionAction", "revokeMode" : "true", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, "action" : "rerender" ] { "kudosLinksDisabled" : "false", } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); ], "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); { } "quiltName" : "ForumMessage", "event" : "MessagesWidgetEditAnswerForm", "event" : "MessagesWidgetEditAction", "context" : "lia-deleted-state", { "action" : "rerender" "context" : "envParam:quiltName", "context" : "", "context" : "", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234240}); LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "useTruncatedSubject" : "true", "action" : "pulsate" ] "action" : "rerender" "context" : "", ] { ] "quiltName" : "ForumMessage", } } "event" : "ProductAnswerComment", }, } { ] ] "context" : "", "event" : "MessagesWidgetEditCommentForm", { }); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenMobilfunkLTE/thread-id/56674","ajaxErrorEventName":"LITHIUM:ajaxError","token":"oXt-d9TyRPAo799r64rbiqtYt9Q3hLvEViRRUerZmPw. } } "disallowZeroCount" : "false", "message" : "1477776", "action" : "rerender" "useSubjectIcons" : "true", ] { { LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "action" : "rerender" { "context" : "", "event" : "MessagesWidgetMessageEdit", "context" : "", { }, "context" : "envParam:feedbackData", ] LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234165}); { "event" : "editProductMessage", ] o.innerHTML = "Page must be in a numeric format. "context" : "envParam:selectedMessage", } { ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1478546 .lia-rating-control-passive', '#form_5'); "eventActions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'fMYrubYS0dxsnauUhdhfYl2_FwI7RzoERuRMv3_bpEg. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "displaySubject" : "true", } "linkDisabled" : "false" "revokeMode" : "true", window.location.replace('/t5/user/userloginpage'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); { ] { "action" : "rerender" "event" : "editProductMessage", ], "event" : "addThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); }, "action" : "rerender" "event" : "unapproveMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { "event" : "approveMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); o.innerHTML = ""; { var keycodes = { }, { "actions" : [ Wie Sie das prüfen und was Sie dagegen machen können, erfahren Sie in … "actions" : [ ] { Upload bei 5 bis 6. { "context" : "", "action" : "rerender" "actions" : [ }, Bist du sicher, dass du fortfahren möchtest? { "initiatorDataMatcher" : "data-lia-kudos-id" }, "displayStyle" : "horizontal", ] event.returnValue = false; LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1478546,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { }, } ] return false; } "context" : "envParam:feedbackData", "action" : "rerender" "action" : "rerender" "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/63029","ajaxErrorEventName":"LITHIUM:ajaxError","token":"4Hw4sJt0EMTC4b9YhXp4GeV0_umj3stHdULg24I1U-0. } "event" : "removeMessageUserEmailSubscription", ] LITHIUM.AjaxSupport.ComponentEvents.set({ $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); $(this).next().toggle(); }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "context" : "", if (1 != val) { "initiatorDataMatcher" : "data-lia-message-uid" // Reset the conditions so that someone can do it all again. "disableKudosForAnonUser" : "false", { Bist du sicher, dass du fortfahren möchtest? "selector" : "#kudosButtonV2_6", { "actions" : [ "context" : "", ] "closeEvent" : "LITHIUM:lightboxCloseEvent", "messageViewOptions" : "1111110111111111111110111110100101001101" { "displayStyle" : "horizontal", "event" : "expandMessage", ] ] "}); ;(function($) { ] } { } { } "actions" : [ "context" : "", "kudosable" : "true", } "event" : "ProductMessageEdit", "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:quiltName,expandedQuiltName", Bundle Offers. "context" : "envParam:quiltName,message,product,contextId,contextUrl", Wegschieben Legen Kreuzworträtsel, Adler Limbach Speisekarte, Pizzeria Rimini Bamberg Speisekarte, Awo-duisburg Fortbildung 2020, Ubierstr 18 Düsseldorf, Java Compare String Alphabetically, Pierdrei Hotel Hafencity Hamburg Parken, Uni Regensburg Erziehungswissenschaft Praktikum, Giulietta E Romeo Verona, "> 0) ) "context" : "", { }, { "kudosable" : "true", }); "context" : "", }); "event" : "deleteMessage", "actions" : [ "disableKudosForAnonUser" : "false", { { "context" : "", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "eventActions" : [ "actions" : [ { "context" : "", }, "useTruncatedSubject" : "true", count = 0; "action" : "rerender" "action" : "pulsate" ', 'ajax'); ] }, "event" : "unapproveMessage", { ] }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/63029","ajaxErrorEventName":"LITHIUM:ajaxError","token":"9_7V-EwZVcOvhrUNcFS1BVw4BfEFAMdvbazZnCy9mGc. "actions" : [ "}); { { }, "defaultAriaLabel" : "", "showCountOnly" : "false", { { ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1546831,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "truncateBodyRetainsHtml" : "false", "action" : "rerender" } "action" : "rerender" }, "actions" : [ Bist du sicher, dass du fortfahren möchtest? "actions" : [ LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "message" : "1477776", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "lia-deleted-state", { ] }, { } "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { return; "message" : "1477754", } ] { // just for convenience, you need a login anyways... LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); { "event" : "AcceptSolutionAction", "actions" : [ "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { "actions" : [ "parameters" : { "event" : "addThreadUserEmailSubscription", "actions" : [ "actions" : [ } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "initiatorDataMatcher" : "data-lia-kudos-id" }, "linkDisabled" : "false" "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1478551,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } { "disableLabelLinks" : "false", "action" : "rerender" "parameters" : { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1478551 .lia-rating-control-passive', '#form_6'); ] "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); // Oops. }, }, "eventActions" : [ "showCountOnly" : "false", "event" : "RevokeSolutionAction", } ] $('div[class*="-menu-btn"]').removeClass('active'); { { ] // Reset the conditions so that someone can do it all again. }, "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "kudoEntity", ] return false; { ] "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234240}); } "action" : "pulsate" "kudosable" : "true", "entity" : "1478644", "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" { "context" : "lia-deleted-state", ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "removeThreadUserEmailSubscription", "context" : "envParam:feedbackData", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); ] }, ] { "; clearWarning(pagerId); > 0) ) "includeRepliesModerationState" : "false", "revokeMode" : "true", { { }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1477797 .lia-rating-control-passive', '#form_4'); { }, "context" : "envParam:feedbackData", // console.log('watching: ' + key); { "actions" : [ "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/63029","ajaxErrorEventName":"LITHIUM:ajaxError","token":"jJjdDkbRxGO2NI9Ae0gDCnPh7Qi0mnrcMJ2T0RWDnjs. }, }, { "actions" : [ ] }, "actions" : [ "context" : "", "action" : "rerender" "disableKudosForAnonUser" : "false", ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, // We made it! { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" } ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { }, "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" "message" : "1477797", ] ] } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, "action" : "rerender" { { { }, "actions" : [ }, "dialogKey" : "dialogKey" { }, "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName,message", "actions" : [ .attr('aria-expanded','true'); "context" : "", { "showCountOnly" : "false", { return; } "event" : "MessagesWidgetEditCommentForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,expandedQuiltName", "activecastFullscreen" : false, "action" : "rerender" } { "linkDisabled" : "false" "action" : "pulsate" "truncateBody" : "true", "initiatorBinding" : true, }, ] "action" : "rerender" } }, "truncateBodyRetainsHtml" : "false", } "event" : "MessagesWidgetAnswerForm", "event" : "approveMessage", { // --> return false; }, }, ] { { ] } "disallowZeroCount" : "false", "context" : "envParam:entity", }, "actions" : [ "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" LITHIUM.Dialog.options['-191854142'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Dazu kann man neben einem Handy-Neustart … }); "; Offres fixes; Cartes prépayées; Offres fixes; Ora CLASSIK. "event" : "MessagesWidgetEditCommentForm", $('#node-menu li.active').children('ul').show(); ] } "actions" : [ "actions" : [ "actions" : [ }, { "includeRepliesModerationState" : "false", "useCountToKudo" : "false", LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); }, "entity" : "1478560", { Bist du sicher, dass du fortfahren möchtest? { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_51","feedbackSelector":".InfoMessage"}); "selector" : "#messageview_7", "event" : "MessagesWidgetEditCommentForm", "actions" : [ "action" : "rerender" // Oops, not the right sequence, lets restart from the top. } } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ "kudosLinksDisabled" : "false", } { count = 0; "event" : "AcceptSolutionAction", "revokeMode" : "true", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", }, "action" : "rerender" ] { "kudosLinksDisabled" : "false", } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); ], "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); { } "quiltName" : "ForumMessage", "event" : "MessagesWidgetEditAnswerForm", "event" : "MessagesWidgetEditAction", "context" : "lia-deleted-state", { "action" : "rerender" "context" : "envParam:quiltName", "context" : "", "context" : "", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234240}); LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); "action" : "rerender" "useTruncatedSubject" : "true", "action" : "pulsate" ] "action" : "rerender" "context" : "", ] { ] "quiltName" : "ForumMessage", } } "event" : "ProductAnswerComment", }, } { ] ] "context" : "", "event" : "MessagesWidgetEditCommentForm", { }); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivStoerungsmeldungenMobilfunkLTE/thread-id/56674","ajaxErrorEventName":"LITHIUM:ajaxError","token":"oXt-d9TyRPAo799r64rbiqtYt9Q3hLvEViRRUerZmPw. } } "disallowZeroCount" : "false", "message" : "1477776", "action" : "rerender" "useSubjectIcons" : "true", ] { { LITHIUM.InputEditForm("form_9", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "action" : "rerender" { "context" : "", "event" : "MessagesWidgetMessageEdit", "context" : "", { }, "context" : "envParam:feedbackData", ] LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234165}); { "event" : "editProductMessage", ] o.innerHTML = "Page must be in a numeric format. "context" : "envParam:selectedMessage", } { ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1478546 .lia-rating-control-passive', '#form_5'); "eventActions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'fMYrubYS0dxsnauUhdhfYl2_FwI7RzoERuRMv3_bpEg. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "displaySubject" : "true", } "linkDisabled" : "false" "revokeMode" : "true", window.location.replace('/t5/user/userloginpage'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); { ] { "action" : "rerender" "event" : "editProductMessage", ], "event" : "addThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "action" : "rerender" LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); }, "action" : "rerender" "event" : "unapproveMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { "event" : "approveMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); o.innerHTML = ""; { var keycodes = { }, { "actions" : [ Wie Sie das prüfen und was Sie dagegen machen können, erfahren Sie in … "actions" : [ ] { Upload bei 5 bis 6. { "context" : "", "action" : "rerender" "actions" : [ }, Bist du sicher, dass du fortfahren möchtest? { "initiatorDataMatcher" : "data-lia-kudos-id" }, "displayStyle" : "horizontal", ] event.returnValue = false; LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1478546,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { }, } ] return false; } "context" : "envParam:feedbackData", "action" : "rerender" "action" : "rerender" "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/63029","ajaxErrorEventName":"LITHIUM:ajaxError","token":"4Hw4sJt0EMTC4b9YhXp4GeV0_umj3stHdULg24I1U-0. } "event" : "removeMessageUserEmailSubscription", ] LITHIUM.AjaxSupport.ComponentEvents.set({ $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); $(this).next().toggle(); }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "context" : "", if (1 != val) { "initiatorDataMatcher" : "data-lia-message-uid" // Reset the conditions so that someone can do it all again. "disableKudosForAnonUser" : "false", { Bist du sicher, dass du fortfahren möchtest? "selector" : "#kudosButtonV2_6", { "actions" : [ "context" : "", ] "closeEvent" : "LITHIUM:lightboxCloseEvent", "messageViewOptions" : "1111110111111111111110111110100101001101" { "displayStyle" : "horizontal", "event" : "expandMessage", ] ] "}); ;(function($) { ] } { } { } "actions" : [ "context" : "", "kudosable" : "true", } "event" : "ProductMessageEdit", "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:quiltName,expandedQuiltName", Bundle Offers. "context" : "envParam:quiltName,message,product,contextId,contextUrl", Wegschieben Legen Kreuzworträtsel, Adler Limbach Speisekarte, Pizzeria Rimini Bamberg Speisekarte, Awo-duisburg Fortbildung 2020, Ubierstr 18 Düsseldorf, Java Compare String Alphabetically, Pierdrei Hotel Hafencity Hamburg Parken, Uni Regensburg Erziehungswissenschaft Praktikum, Giulietta E Romeo Verona, ">
Updating…
  • Es befinden sich keine Produkte im Warenkorb.