430) { "context" : "", ] "actions" : [ Dann hast Du nun 4 Wochen Zeit, der Kündigung zu widersprechen. ] { "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ', 'ajax'); "context" : "", "event" : "deleteMessage", "action" : "rerender" }); "truncateBody" : "true", }, "}); "actions" : [ return; "actions" : [ ] { { { LITHIUM.Dialog.options['355061192'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; var count = 0; { "kudosable" : "true", ], watching = false; }, LITHIUM.Dialog({ } }, "initiatorBinding" : true, Bist du sicher, dass du fortfahren möchtest? "actions" : [ "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditCommentForm", { ] CallYa Digital ist der erste monatlich kündbare Mobilfunktarif von Vodafone. Die Kündigung bezieht sich nur auf eine Kundennummer. { "}); }); ], var handleClose = function(event) { }, "actions" : [ { ctaHTML += 'Stell Deine Frage'; "event" : "QuickReply", Bist du sicher, dass du fortfahren möchtest? "event" : "QuickReply", ] ctaHTML += "Lösung noch nicht gefunden? Aktuell bekommt ihr zum Vodafone CallYa Digital Prepaid Tarif, der euch 20€ pro 4 Wochen kostet, 60€ Guthaben von Vodafone geschenkt. "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? ] }, "}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. } } "useSubjectIcons" : "true", }, { .attr('aria-hidden','false') "disableKudosForAnonUser" : "false", "linkDisabled" : "false" "event" : "editProductMessage", "event" : "AcceptSolutionAction", { }, }, "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "ProductAnswer", "context" : "", } "includeRepliesModerationState" : "false", "event" : "expandMessage", "action" : "rerender" { ] "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "actions" : [ "event" : "ProductAnswerComment", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { "truncateBodyRetainsHtml" : "false", { Scheinbar kann man online nicht kündigen (kein Einstellung gefunden), sondern muss eine "Verzichtserklärung für die Mitnahme ihrer Callya-Rufnummer" absenden. { LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "}); "action" : "rerender" "action" : "rerender" $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); } { "event" : "ProductAnswer", "componentId" : "kudos.widget.button", } "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); LITHIUM.Dialog.options['355061192'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_17c8127e6d520e","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", "actions" : [ }, { "action" : "rerender" ] "event" : "expandMessage", "context" : "envParam:entity", { "actions" : [ }, { "actions" : [ "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "action" : "rerender" } ] window.location.replace('/t5/user/userloginpage'); "event" : "addThreadUserEmailSubscription", "event" : "markAsSpamWithoutRedirect", "event" : "MessagesWidgetAnswerForm", "action" : "pulsate" "context" : "envParam:feedbackData", var notifCount = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); { Aber Obacht, auch wenn der Name CallYa Digital an eine Prepaid-Lösung erinnert, so ist es vielmehr ein Laufzeitvertrag mit monatlicher Kündigung. Vodafone Kündigung - Vorlage Deutsch: Mit der vorgefertigten Vodafone Kündigung - Vorlage kündigen Sie Ihren Vodafone Handyvertrag im Nu. "action" : "pulsate" if(do_scroll == "true"){ ] ] "quiltName" : "ForumMessage", $(this).next().toggle(); var element = $(this).parent('li'); "actions" : [ "context" : "envParam:feedbackData", "activecastFullscreen" : false, "actions" : [ }, ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); if (element.hasClass('active')) { if ( watching ) { // --> { }, "revokeMode" : "true", Darum kannst Du künftig auf MeinVodafone "event" : "QuickReply", "context" : "envParam:quiltName,message", "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "action" : "rerender" Prepaid-Tarife bieten im Gegensatz zu Laufzeitverträgen mehr Unabhängigkeit und eine bessere Kostenkontrolle. ;(function($) { "context" : "", "componentId" : "forums.widget.message-view", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ } { "eventActions" : [ LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); }, 25€ Amazon.de/BestChoice-Gutschein sichern – so geht’s: Bonus-Deal hier aufrufen; E-Mail-Adresse hinterlegen; Vodafone CallYa Digital … "action" : "rerender" "useTruncatedSubject" : "true", ] { "revokeMode" : "true", } }, ] { "actions" : [ $('#vodafone-community-header .lia-search-input-wrapper').hide(); "useTruncatedSubject" : "true", "useTruncatedSubject" : "true", "context" : "", })(LITHIUM.jQuery); if ( key == neededkeys[0] ) { { "parameters" : { "action" : "rerender" }); LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "pulsate" Execute whatever should happen when entering the right sequence "actions" : [ "action" : "rerender" $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() Jetzt registrieren count++; }, "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, '5S3OudAIoA0WWOjzT_sJ1HHGAltotaOEwDF2nBmWoSA. "event" : "editProductMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" "actions" : [ ] "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { Wenn Du Deine Prepaid-Karte länger als 90 Tage nicht nutzt, können wir Deinen CallYa-Vertrag kündigen. "action" : "pulsate" count = 0; "event" : "expandMessage", ;(function($) { "linkDisabled" : "false" })(LITHIUM.jQuery); "event" : "markAsSpamWithoutRedirect", ], { } { }, "action" : "rerender" count = 0; } } { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; // --> LITHIUM.Dialog.options['-292137550'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "selector" : "#kudosButtonV2_1", "initiatorDataMatcher" : "data-lia-kudos-id" ] if ( !watching ) { } } } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "}); { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "context" : "envParam:quiltName,product,contextId,contextUrl", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":369,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYNBVpWBlAFBhgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQBgcGCwEOVhQHBlcFSQEKAAtID1BaC08AAlNRC1UBUQIDAAdAThUPVn1bVgB\/AhsIQCFWCFlqVRBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "accessibility" : false, { "message" : "2045377", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", var watching = false; LITHIUM.AjaxSupport.ComponentEvents.set({ { $(document).ready(function(){ { { if ( count == neededkeys.length ) { "context" : "lia-deleted-state", } "actions" : [ "initiatorBinding" : true, }, element.siblings('li').find('ul').slideUp(); watching = false; .attr('aria-expanded','false') "action" : "pulsate" "dialogContentCssClass" : "lia-panel-dialog-content", "useTruncatedSubject" : "true", "forceSearchRequestParameterForBlurbBuilder" : "false", } "event" : "MessagesWidgetEditAction", //resetMenu(); "actions" : [ "event" : "approveMessage", "event" : "QuickReply", { "actions" : [ "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }); "action" : "rerender" }); "actions" : [ Für einen Paketpreis von gerade einmal 20 Euro schaltet Vodafone bei CallYa Digital ein recht ordentliches LTE Highspeed-Volumen von 10 GB frei. ] "context" : "envParam:quiltName", { $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "context" : "", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); }, ] // We're good so far. "message" : "2045416", "forceSearchRequestParameterForBlurbBuilder" : "false", }, "event" : "addThreadUserEmailSubscription", ], "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-click", // Set start to true only if the first key in the sequence is pressed LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); } "context" : "envParam:quiltName,product,contextId,contextUrl", } { } // enable redirect to login page when "logmein" is typed into the void =) ] }, "actions" : [ "truncateBodyRetainsHtml" : "false", } if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "kudosable" : "true", } { } "event" : "addMessageUserEmailSubscription", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "kudosLinksDisabled" : "false", // Set start to true only if the first key in the sequence is pressed "event" : "unapproveMessage", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "actions" : [ "event" : "AcceptSolutionAction", lithstudio: [], { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "actions" : [ { "actions" : [ ] { .attr('aria-selected','false'); "event" : "markAsSpamWithoutRedirect", //}); { } ] // console.log(key); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); { var keycodes = { "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "addThreadUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "showCountOnly" : "false", $(this).next().toggle(); //$('#lia-body').addClass('lia-window-scroll'); ] "action" : "rerender" LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_17c8127e6d520e","nodesModel":{"CallYa|forum-board":{"title":"Board-Suche: CallYa","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_17c8127e6d520e_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden. "accessibility" : false, "eventActions" : [ }); { }, } { { ', 'ajax'); "actions" : [ "context" : "", } "truncateBodyRetainsHtml" : "false", } Um diese zu nutzen, können Sie einfach nach Vertragsende Guthaben auf Ihre Karte laden und Sie werden automatisch den Prepaid-Tarif CallYa Talk&SMS nutzen. } //resetMenu(); }); LITHIUM.AjaxSupport.useTickets = false; Klinikum Klagenfurt Befundanforderung, Aok Niedersachsen Hannover, Aok Niedersachsen Pflegekasse Adresse, Getränke Hoffmann Potsdam, Aromatisches Heißgetränk 11 Buchstaben, Sport Nach Kaiserschnitt Abnehmen, Männl Wasservogel Kreuzworträtsel, Haus Kaufen Wismar Ohne Makler, Mond Konjunktion Pluto Transit, "> 430) { "context" : "", ] "actions" : [ Dann hast Du nun 4 Wochen Zeit, der Kündigung zu widersprechen. ] { "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ', 'ajax'); "context" : "", "event" : "deleteMessage", "action" : "rerender" }); "truncateBody" : "true", }, "}); "actions" : [ return; "actions" : [ ] { { { LITHIUM.Dialog.options['355061192'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; var count = 0; { "kudosable" : "true", ], watching = false; }, LITHIUM.Dialog({ } }, "initiatorBinding" : true, Bist du sicher, dass du fortfahren möchtest? "actions" : [ "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditCommentForm", { ] CallYa Digital ist der erste monatlich kündbare Mobilfunktarif von Vodafone. Die Kündigung bezieht sich nur auf eine Kundennummer. { "}); }); ], var handleClose = function(event) { }, "actions" : [ { ctaHTML += 'Stell Deine Frage'; "event" : "QuickReply", Bist du sicher, dass du fortfahren möchtest? "event" : "QuickReply", ] ctaHTML += "Lösung noch nicht gefunden? Aktuell bekommt ihr zum Vodafone CallYa Digital Prepaid Tarif, der euch 20€ pro 4 Wochen kostet, 60€ Guthaben von Vodafone geschenkt. "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? ] }, "}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. } } "useSubjectIcons" : "true", }, { .attr('aria-hidden','false') "disableKudosForAnonUser" : "false", "linkDisabled" : "false" "event" : "editProductMessage", "event" : "AcceptSolutionAction", { }, }, "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "ProductAnswer", "context" : "", } "includeRepliesModerationState" : "false", "event" : "expandMessage", "action" : "rerender" { ] "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "actions" : [ "event" : "ProductAnswerComment", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { "truncateBodyRetainsHtml" : "false", { Scheinbar kann man online nicht kündigen (kein Einstellung gefunden), sondern muss eine "Verzichtserklärung für die Mitnahme ihrer Callya-Rufnummer" absenden. { LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "}); "action" : "rerender" "action" : "rerender" $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); } { "event" : "ProductAnswer", "componentId" : "kudos.widget.button", } "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); LITHIUM.Dialog.options['355061192'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { { LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_17c8127e6d520e","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", "actions" : [ }, { "action" : "rerender" ] "event" : "expandMessage", "context" : "envParam:entity", { "actions" : [ }, { "actions" : [ "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "action" : "rerender" } ] window.location.replace('/t5/user/userloginpage'); "event" : "addThreadUserEmailSubscription", "event" : "markAsSpamWithoutRedirect", "event" : "MessagesWidgetAnswerForm", "action" : "pulsate" "context" : "envParam:feedbackData", var notifCount = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); { Aber Obacht, auch wenn der Name CallYa Digital an eine Prepaid-Lösung erinnert, so ist es vielmehr ein Laufzeitvertrag mit monatlicher Kündigung. Vodafone Kündigung - Vorlage Deutsch: Mit der vorgefertigten Vodafone Kündigung - Vorlage kündigen Sie Ihren Vodafone Handyvertrag im Nu. "action" : "pulsate" if(do_scroll == "true"){ ] ] "quiltName" : "ForumMessage", $(this).next().toggle(); var element = $(this).parent('li'); "actions" : [ "context" : "envParam:feedbackData", "activecastFullscreen" : false, "actions" : [ }, ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); if (element.hasClass('active')) { if ( watching ) { // --> { }, "revokeMode" : "true", Darum kannst Du künftig auf MeinVodafone "event" : "QuickReply", "context" : "envParam:quiltName,message", "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "action" : "rerender" Prepaid-Tarife bieten im Gegensatz zu Laufzeitverträgen mehr Unabhängigkeit und eine bessere Kostenkontrolle. ;(function($) { "context" : "", "componentId" : "forums.widget.message-view", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ } { "eventActions" : [ LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); }, 25€ Amazon.de/BestChoice-Gutschein sichern – so geht’s: Bonus-Deal hier aufrufen; E-Mail-Adresse hinterlegen; Vodafone CallYa Digital … "action" : "rerender" "useTruncatedSubject" : "true", ] { "revokeMode" : "true", } }, ] { "actions" : [ $('#vodafone-community-header .lia-search-input-wrapper').hide(); "useTruncatedSubject" : "true", "useTruncatedSubject" : "true", "context" : "", })(LITHIUM.jQuery); if ( key == neededkeys[0] ) { { "parameters" : { "action" : "rerender" }); LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "pulsate" Execute whatever should happen when entering the right sequence "actions" : [ "action" : "rerender" $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() Jetzt registrieren count++; }, "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, '5S3OudAIoA0WWOjzT_sJ1HHGAltotaOEwDF2nBmWoSA. "event" : "editProductMessage", LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" "actions" : [ ] "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { Wenn Du Deine Prepaid-Karte länger als 90 Tage nicht nutzt, können wir Deinen CallYa-Vertrag kündigen. "action" : "pulsate" count = 0; "event" : "expandMessage", ;(function($) { "linkDisabled" : "false" })(LITHIUM.jQuery); "event" : "markAsSpamWithoutRedirect", ], { } { }, "action" : "rerender" count = 0; } } { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; // --> LITHIUM.Dialog.options['-292137550'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "selector" : "#kudosButtonV2_1", "initiatorDataMatcher" : "data-lia-kudos-id" ] if ( !watching ) { } } } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "}); { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "context" : "envParam:quiltName,product,contextId,contextUrl", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":369,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYNBVpWBlAFBhgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQBgcGCwEOVhQHBlcFSQEKAAtID1BaC08AAlNRC1UBUQIDAAdAThUPVn1bVgB\/AhsIQCFWCFlqVRBJFA1aYAcRQzIHYkFXF09EAxAxJ3shdmcUWwEWIGt9L0JaAUZAVVUARUZueicwckRBXERbBhgPXQ9dQnsteHpgEloUG0Q="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "accessibility" : false, { "message" : "2045377", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", var watching = false; LITHIUM.AjaxSupport.ComponentEvents.set({ { $(document).ready(function(){ { { if ( count == neededkeys.length ) { "context" : "lia-deleted-state", } "actions" : [ "initiatorBinding" : true, }, element.siblings('li').find('ul').slideUp(); watching = false; .attr('aria-expanded','false') "action" : "pulsate" "dialogContentCssClass" : "lia-panel-dialog-content", "useTruncatedSubject" : "true", "forceSearchRequestParameterForBlurbBuilder" : "false", } "event" : "MessagesWidgetEditAction", //resetMenu(); "actions" : [ "event" : "approveMessage", "event" : "QuickReply", { "actions" : [ "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }); "action" : "rerender" }); "actions" : [ Für einen Paketpreis von gerade einmal 20 Euro schaltet Vodafone bei CallYa Digital ein recht ordentliches LTE Highspeed-Volumen von 10 GB frei. ] "context" : "envParam:quiltName", { $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "context" : "", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); }, ] // We're good so far. "message" : "2045416", "forceSearchRequestParameterForBlurbBuilder" : "false", }, "event" : "addThreadUserEmailSubscription", ], "actions" : [ "triggerSelector" : ".lia-panel-dialog-trigger-event-click", // Set start to true only if the first key in the sequence is pressed LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); } "context" : "envParam:quiltName,product,contextId,contextUrl", } { } // enable redirect to login page when "logmein" is typed into the void =) ] }, "actions" : [ "truncateBodyRetainsHtml" : "false", } if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "kudosable" : "true", } { } "event" : "addMessageUserEmailSubscription", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "kudosLinksDisabled" : "false", // Set start to true only if the first key in the sequence is pressed "event" : "unapproveMessage", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "actions" : [ "event" : "AcceptSolutionAction", lithstudio: [], { "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "actions" : [ { "actions" : [ ] { .attr('aria-selected','false'); "event" : "markAsSpamWithoutRedirect", //}); { } ] // console.log(key); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); { var keycodes = { "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "addThreadUserEmailSubscription", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "showCountOnly" : "false", $(this).next().toggle(); //$('#lia-body').addClass('lia-window-scroll'); ] "action" : "rerender" LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_17c8127e6d520e","nodesModel":{"CallYa|forum-board":{"title":"Board-Suche: CallYa","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_17c8127e6d520e_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); Mit der automatischen Vorschlagsfunktion können Sie Ihre Suchergebnisse eingrenzen, da während der Eingabe mögliche Treffer angezeigt werden. "accessibility" : false, "eventActions" : [ }); { }, } { { ', 'ajax'); "actions" : [ "context" : "", } "truncateBodyRetainsHtml" : "false", } Um diese zu nutzen, können Sie einfach nach Vertragsende Guthaben auf Ihre Karte laden und Sie werden automatisch den Prepaid-Tarif CallYa Talk&SMS nutzen. } //resetMenu(); }); LITHIUM.AjaxSupport.useTickets = false; Klinikum Klagenfurt Befundanforderung, Aok Niedersachsen Hannover, Aok Niedersachsen Pflegekasse Adresse, Getränke Hoffmann Potsdam, Aromatisches Heißgetränk 11 Buchstaben, Sport Nach Kaiserschnitt Abnehmen, Männl Wasservogel Kreuzworträtsel, Haus Kaufen Wismar Ohne Makler, Mond Konjunktion Pluto Transit, ">
Updating…
  • Es befinden sich keine Produkte im Warenkorb.